Lineage for d4meva_ (4mev A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522024Protein TRAP dicarboxylate transporter [267666] (2 species)
  7. 2522027Species Rhodoferax ferrireducens [TaxId:338969] [267751] (2 PDB entries)
  8. 2522031Domain d4meva_: 4mev A: [266732]
    automated match to d4mcob_
    complexed with cit, mli

Details for d4meva_

PDB Entry: 4mev (more details), 1.8 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422
PDB Compounds: (A:) TRAP dicarboxylate transporter-DctP subunit

SCOPe Domain Sequences for d4meva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4meva_ c.94.1.1 (A:) TRAP dicarboxylate transporter {Rhodoferax ferrireducens [TaxId: 338969]}
salkishqfpggtikegdfrdrlvrnfaaevekrskgamkfeiypgsslmktnaqfssmr
kgaldmaliplsyaggevpelniglmpglvvsyeqayswktkpvgieltrvlqekgivli
swiwqaggvasrgkpvvepedakgmkirggsremdmilkdagaavvslpsneiyaamqtg
amdaamtsstsfisfrleevakalttgrtgaywfmfeplmmskaifdklpkdqrdmlmtv
gaemekfaleaakkddidvaavyqkagakvvdlsdgtikkwqdiarktawkdygaknegc
akllalaqqtl

SCOPe Domain Coordinates for d4meva_:

Click to download the PDB-style file with coordinates for d4meva_.
(The format of our PDB-style files is described here.)

Timeline for d4meva_: