| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
| Protein TRAP dicarboxylate transporter [267666] (2 species) |
| Species Rhodoferax ferrireducens [TaxId:338969] [267751] (2 PDB entries) |
| Domain d4meva_: 4mev A: [266732] automated match to d4mcob_ complexed with cit, mli |
PDB Entry: 4mev (more details), 1.8 Å
SCOPe Domain Sequences for d4meva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4meva_ c.94.1.1 (A:) TRAP dicarboxylate transporter {Rhodoferax ferrireducens [TaxId: 338969]}
salkishqfpggtikegdfrdrlvrnfaaevekrskgamkfeiypgsslmktnaqfssmr
kgaldmaliplsyaggevpelniglmpglvvsyeqayswktkpvgieltrvlqekgivli
swiwqaggvasrgkpvvepedakgmkirggsremdmilkdagaavvslpsneiyaamqtg
amdaamtsstsfisfrleevakalttgrtgaywfmfeplmmskaifdklpkdqrdmlmtv
gaemekfaleaakkddidvaavyqkagakvvdlsdgtikkwqdiarktawkdygaknegc
akllalaqqtl
Timeline for d4meva_: