![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein TRAP dicarboxylate transporter [267666] (2 species) |
![]() | Species Rhodoferax ferrireducens [TaxId:338969] [267751] (2 PDB entries) |
![]() | Domain d4mcoc1: 4mco C:28-338 [266730] Other proteins in same PDB: d4mcoa2, d4mcob2, d4mcoc2 complexed with epe, mli has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4mco (more details), 1.6 Å
SCOPe Domain Sequences for d4mcoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mcoc1 c.94.1.1 (C:28-338) TRAP dicarboxylate transporter {Rhodoferax ferrireducens [TaxId: 338969]} salkishqfpggtikegdfrdrlvrnfaaevekrskgamkfeiypgsslmktnaqfssmr kgaldmaliplsyaggevpelniglmpglvvsyeqayswktkpvgieltrvlqekgivli swiwqaggvasrgkpvvepedakgmkirggsremdmilkdagaavvslpsneiyaamqtg amdaamtsstsfisfrleevakalttgrtgaywfmfeplmmskaifdklpkdqrdmlmtv gaemekfaleaakkddidvaavyqkagakvvdlsdgtikkwqdiarktawkdygaknegc akllalaqqtl
Timeline for d4mcoc1:
![]() Domains from other chains: (mouse over for more information) d4mcoa1, d4mcoa2, d4mcob1, d4mcob2 |