Lineage for d4mcoc1 (4mco C:28-338)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914672Protein TRAP dicarboxylate transporter [267666] (2 species)
  7. 2914675Species Rhodoferax ferrireducens [TaxId:338969] [267751] (2 PDB entries)
  8. 2914678Domain d4mcoc1: 4mco C:28-338 [266730]
    Other proteins in same PDB: d4mcoa2, d4mcob2, d4mcoc2
    complexed with epe, mli
    has additional insertions and/or extensions that are not grouped together

Details for d4mcoc1

PDB Entry: 4mco (more details), 1.6 Å

PDB Description: Crystal structure of a TRAP periplasmic solute binding protein from Rhodoferax ferrireducens (Rfer_1840), target EFI-510211, with bound malonate
PDB Compounds: (C:) TRAP dicarboxylate transporter-DctP subunit

SCOPe Domain Sequences for d4mcoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcoc1 c.94.1.1 (C:28-338) TRAP dicarboxylate transporter {Rhodoferax ferrireducens [TaxId: 338969]}
salkishqfpggtikegdfrdrlvrnfaaevekrskgamkfeiypgsslmktnaqfssmr
kgaldmaliplsyaggevpelniglmpglvvsyeqayswktkpvgieltrvlqekgivli
swiwqaggvasrgkpvvepedakgmkirggsremdmilkdagaavvslpsneiyaamqtg
amdaamtsstsfisfrleevakalttgrtgaywfmfeplmmskaifdklpkdqrdmlmtv
gaemekfaleaakkddidvaavyqkagakvvdlsdgtikkwqdiarktawkdygaknegc
akllalaqqtl

SCOPe Domain Coordinates for d4mcoc1:

Click to download the PDB-style file with coordinates for d4mcoc1.
(The format of our PDB-style files is described here.)

Timeline for d4mcoc1: