SCOPe 2.08: Domain d4mcoc1: 4mco C:28-338

Lineage for d4mcoc1 (4mco C:28-338)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein TRAP dicarboxylate transporter [267666] (2 species)

7. Species Rhodoferax ferrireducens [TaxId:338969] [267751] (2 PDB entries)

8. Domain d4mcoc1: 4mco C:28-338 [266730]
   Other proteins in same PDB: d4mcoa2, d4mcob2, d4mcoc2
   complexed with epe, mli
   has additional insertions and/or extensions that are not grouped together

Details for d4mcoc1

PDB Entry: 4mco, 1.6 Å

PDB Description: Crystal structure of a TRAP periplasmic solute binding protein from Rhodoferax ferrireducens (Rfer_1840), target EFI-510211, with bound malonate

PDB Compounds: (C:) TRAP dicarboxylate transporter-DctP subunit

SCOPe Domain Sequences for d4mcoc1:

Sequence; same for both SEQRES and ATOM records:

>d4mcoc1 c.94.1.1 (C:28-338) TRAP dicarboxylate transporter {Rhodoferax ferrireducens [TaxId: 338969]}
salkishqfpggtikegdfrdrlvrnfaaevekrskgamkfeiypgsslmktnaqfssmr
kgaldmaliplsyaggevpelniglmpglvvsyeqayswktkpvgieltrvlqekgivli
swiwqaggvasrgkpvvepedakgmkirggsremdmilkdagaavvslpsneiyaamqtg
amdaamtsstsfisfrleevakalttgrtgaywfmfeplmmskaifdklpkdqrdmlmtv
gaemekfaleaakkddidvaavyqkagakvvdlsdgtikkwqdiarktawkdygaknegc
akllalaqqtl

Timeline for d4mcoc1:

• d4mcoc1 first appeared in SCOPe 2.05, called d4mcoc_
  
• d4mcoc1 appears in SCOPe 2.07