Lineage for d4m80a_ (4m80 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094316Protein automated matches [190057] (26 species)
    not a true protein
  7. 2094464Species Yeast (Candida albicans) [TaxId:5476] [188406] (8 PDB entries)
  8. 2094471Domain d4m80a_: 4m80 A: [266725]
    automated match to d3n9ka_

Details for d4m80a_

PDB Entry: 4m80 (more details), 1.86 Å

PDB Description: The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution
PDB Compounds: (A:) exo-1,3-beta-glucanase

SCOPe Domain Sequences for d4m80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m80a_ c.1.8.3 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
wdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalril
qkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarknn
irvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvigi
ellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqwn
vvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagswsaaltdcakwlngv
nrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswkt
enapewsfqtltynglfpqpvtdrqfpnqcgfh

SCOPe Domain Coordinates for d4m80a_:

Click to download the PDB-style file with coordinates for d4m80a_.
(The format of our PDB-style files is described here.)

Timeline for d4m80a_: