Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (26 species) not a true protein |
Species Yeast (Candida albicans) [TaxId:5476] [188406] (8 PDB entries) |
Domain d4m80a_: 4m80 A: [266725] automated match to d3n9ka_ |
PDB Entry: 4m80 (more details), 1.86 Å
SCOPe Domain Sequences for d4m80a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m80a_ c.1.8.3 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]} wdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalril qkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarknn irvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvigi ellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqwn vvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagswsaaltdcakwlngv nrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswkt enapewsfqtltynglfpqpvtdrqfpnqcgfh
Timeline for d4m80a_: