SCOPe 2.05: Domain d4m7yb_: 4m7y B:

Lineage for d4m7yb_ (4m7y B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.14: Fumble-like [159623] (4 proteins)
   Pfam PF03630; type II pantothenate kinase-like

6. Protein automated matches [259360] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [259361] (2 PDB entries)

8. Domain d4m7yb_: 4m7y B: [266724]
   automated match to d2ewsa1
   complexed with 2gh, adp, po4, unx

Details for d4m7yb_

PDB Entry: 4m7y, 1.8 Å

PDB Description: staphylococcus aureus type ii pantothenate kinase in complex with a pantothenate analog

PDB Compounds: (B:) Type II pantothenate kinase

SCOPe Domain Sequences for d4m7yb_:

Sequence; same for both SEQRES and ATOM records:

>d4m7yb_ c.55.1.14 (B:) automated matches {Staphylococcus aureus [TaxId: 196620]}
mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
tvlrgckpyyvengafsgaigalyle

Timeline for d4m7yb_:

• d4m7yb_ is new in SCOPe 2.05-stable
  
• d4m7yb_ appears in SCOPe 2.06
  
• d4m7yb_ appears in the current release, SCOPe 2.08