![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries) |
![]() | Domain d4m6bd2: 4m6b D:131-222 [266722] automated match to d2jssa1 |
PDB Entry: 4m6b (more details), 1.78 Å
SCOPe Domain Sequences for d4m6bd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m6bd2 a.22.1.1 (D:131-222) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} qsssaraglqfpvgrikrylkrhatgrtrvgskaaiyltavleyltaevlelagnaakdl kvkritprhlqlairgddeldsliratiasgg
Timeline for d4m6bd2: