SCOPe 2.08: Domain d4m6bd1: 4m6b D:36-130

Lineage for d4m6bd1 (4m6b D:36-130)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries)

8. Domain d4m6bd1: 4m6b D:36-130 [266721]
   automated match to d2jssa2

Details for d4m6bd1

PDB Entry: 4m6b, 1.78 Å

PDB Description: crystal structure of yeast swr1-z domain in complex with h2a.z-h2b dimer

PDB Compounds: (D:) Chimera protein of Histone H2B.1 and Histone H2A.Z

SCOPe Domain Sequences for d4m6bd1:

Sequence; same for both SEQRES and ATOM records:

>d4m6bd1 a.22.1.1 (D:36-130) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
rketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisar
eiqtavrlilpgelakhavsegtravtkyssstqa

Timeline for d4m6bd1:

• d4m6bd1 first appeared in SCOPe 2.05
  
• d4m6bd1 appears in SCOPe 2.07