Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries) |
Domain d4m6bd1: 4m6b D:36-130 [266721] automated match to d2jssa2 |
PDB Entry: 4m6b (more details), 1.78 Å
SCOPe Domain Sequences for d4m6bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m6bd1 a.22.1.1 (D:36-130) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} rketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisar eiqtavrlilpgelakhavsegtravtkyssstqa
Timeline for d4m6bd1: