Lineage for d4m6ba1 (4m6b A:37-130)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698706Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries)
  8. 2698711Domain d4m6ba1: 4m6b A:37-130 [266719]
    automated match to d2jssa2

Details for d4m6ba1

PDB Entry: 4m6b (more details), 1.78 Å

PDB Description: crystal structure of yeast swr1-z domain in complex with h2a.z-h2b dimer
PDB Compounds: (A:) Chimera protein of Histone H2B.1 and Histone H2A.Z

SCOPe Domain Sequences for d4m6ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m6ba1 a.22.1.1 (A:37-130) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisare
iqtavrlilpgelakhavsegtravtkyssstqa

SCOPe Domain Coordinates for d4m6ba1:

Click to download the PDB-style file with coordinates for d4m6ba1.
(The format of our PDB-style files is described here.)

Timeline for d4m6ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m6ba2