SCOPe 2.07: Domain d4m5na1: 4m5n A:0-158

Lineage for d4m5na1 (4m5n A:0-158)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures
   automatically mapped to Pfam PF01288

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (2 proteins)

6. Protein automated matches [238182] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [238183] (14 PDB entries)

8. Domain d4m5na1: 4m5n A:0-158 [266717]
   Other proteins in same PDB: d4m5na2, d4m5nb2
   automated match to d4m5ha_
   complexed with apc, mg, yh7

Details for d4m5na1

PDB Entry: 4m5n, 2 Å

PDB Description: The Identification, Analysis and Structure-Based Development of Novel Inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase

PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d4m5na1:

Sequence; same for both SEQRES and ATOM records:

>d4m5na1 d.58.30.1 (A:0-158) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mtvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaava
letslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmk
nrgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

Timeline for d4m5na1:

• d4m5na1 first appeared in SCOPe 2.05, called d4m5na_
  
• d4m5na1 appears in SCOPe 2.06
  
• d4m5na1 appears in the current release, SCOPe 2.08