Lineage for d4lzda2 (4lzd A:231-289)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001966Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2002227Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. 2002228Protein automated matches [254483] (3 species)
    not a true protein
  7. 2002229Species Human (Homo sapiens) [TaxId:9606] [255047] (5 PDB entries)
  8. 2002232Domain d4lzda2: 4lzd A:231-289 [266711]
    Other proteins in same PDB: d4lzda1, d4lzda3
    automated match to d2ihma2
    complexed with cl, edo, imd, na

Details for d4lzda2

PDB Entry: 4lzd (more details), 1.85 Å

PDB Description: human dna polymerase mu- apoenzyme
PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d4lzda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lzda2 a.60.12.0 (A:231-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seryqtmklftqifgvgvktadrwyreglrtlddlreqpqkltqqqkaglqhhqdlstp

SCOPe Domain Coordinates for d4lzda2:

Click to download the PDB-style file with coordinates for d4lzda2.
(The format of our PDB-style files is described here.)

Timeline for d4lzda2: