SCOPe 2.02: Domain d1c6yb_: 1c6y B:

Lineage for d1c6yb_ (1c6y B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (7 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (413 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d1c6yb_: 1c6y B: [26671]
   complexed with mk1

Details for d1c6yb_

PDB Entry: 1c6y, 2.5 Å

PDB Description: alternate binding site for the p1-p3 group of a class of potent hiv-1 protease inhibitors as a result of concerted structural change in 80's loop.

PDB Compounds: (B:) protein (protease)

SCOPe Domain Sequences for d1c6yb_:

Sequence; same for both SEQRES and ATOM records:

>d1c6yb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlltqigctlnf

Timeline for d1c6yb_:

• d1c6yb_ first appeared (with stable ids) in SCOP 1.55
  
• d1c6yb_ appears in SCOPe 2.01
  
• d1c6yb_ appears in SCOPe 2.03
  
• d1c6yb_ appears in the current release, SCOPe 2.08