SCOPe 2.05: Domain d4lsrl2: 4lsr L:107-212

Lineage for d4lsrl2 (4lsr L:107-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4lsrl2: 4lsr L:107-212 [266700]
   Other proteins in same PDB: d4lsrl1
   automated match to d1dn0a2
   complexed with nag, so4; mutant

Details for d4lsrl2

PDB Entry: 4lsr, 2.28 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc- ch31 in complex with hiv-1 clade a/e stran 93th057 gp120 with loop d and loop v5 from clade a strain ker_2018_11

PDB Compounds: (L:) light chain of antibody vrc-ch31 (n70d mutation)

SCOPe Domain Sequences for d4lsrl2:

Sequence; same for both SEQRES and ATOM records:

>d4lsrl2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4lsrl2:

• d4lsrl2 is new in SCOPe 2.05-stable
  
• d4lsrl2 appears in SCOPe 2.06
  
• d4lsrl2 appears in the current release, SCOPe 2.08