Lineage for d4lsrl1 (4lsr L:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356206Domain d4lsrl1: 4lsr L:1-106 [266699]
    Other proteins in same PDB: d4lsrl2
    automated match to d1dn0a1
    complexed with nag, so4; mutant

Details for d4lsrl1

PDB Entry: 4lsr (more details), 2.28 Å

PDB Description: Crystal structure of broadly and potently neutralizing antibody VRC-CH31 in complex with HIV-1 clade A/E stran 93TH057 gp120 with LOOP D and Loop V5 from clade A strain KER_2018_11
PDB Compounds: (L:) light chain of antibody vrc-ch31 (n70d mutation)

SCOPe Domain Sequences for d4lsrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lsrl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsaslgdrvtitcqasrgigkdlnwyqqkagkapkllvsdastleggvps
rfsgsgfhqdfsltisslqaedvatyfcqqyetfgqgtkvdi

SCOPe Domain Coordinates for d4lsrl1:

Click to download the PDB-style file with coordinates for d4lsrl1.
(The format of our PDB-style files is described here.)

Timeline for d4lsrl1: