SCOPe 2.06: Domain d4lsna2: 4lsn A:430-548

Lineage for d4lsna2 (4lsn A:430-548)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries)

8. Domain d4lsna2: 4lsn A:430-548 [266697]
   Other proteins in same PDB: d4lsna1, d4lsna3, d4lsnb_
   automated match to d2ykna2
   complexed with 1yr

Details for d4lsna2

PDB Entry: 4lsn, 3.1 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with (e)- 3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)- yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4lsna2:

Sequence; same for both SEQRES and ATOM records:

>d4lsna2 c.55.3.0 (A:430-548) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqv

Timeline for d4lsna2:

• d4lsna2 first appeared in SCOPe 2.05
  
• d4lsna2 appears in SCOPe 2.07
  
• d4lsna2 appears in the current release, SCOPe 2.08