![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [238173] (5 PDB entries) |
![]() | Domain d4ls8a1: 4ls8 A:1-251 [266692] Other proteins in same PDB: d4ls8a3, d4ls8b3 automated match to d2alma1 complexed with 1xg, cl, edo, na |
PDB Entry: 4ls8 (more details), 2.1 Å
SCOPe Domain Sequences for d4ls8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ls8a1 c.95.1.0 (A:1-251) automated matches {Bacillus subtilis [TaxId: 224308]} mtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnve dymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgiggletlesqfe ifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqr gdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivl eelehalarga
Timeline for d4ls8a1: