Lineage for d4ls7b1 (4ls7 B:0-250)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917421Species Bacillus subtilis [TaxId:224308] [238173] (5 PDB entries)
  8. 2917428Domain d4ls7b1: 4ls7 B:0-250 [266690]
    Other proteins in same PDB: d4ls7b3
    automated match to d2alma1
    complexed with 1x9, gol, k

Details for d4ls7b1

PDB Entry: 4ls7 (more details), 1.67 Å

PDB Description: Crystal structure of Bacillus subtilis beta-ketoacyl-ACP synthase II (FabF) in a non-covalent complex with cerulenin
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4ls7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ls7b1 c.95.1.0 (B:0-250) automated matches {Bacillus subtilis [TaxId: 224308]}
mtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnve
dymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgiggletlesqfe
ifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqr
gdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivl
eelehalarga

SCOPe Domain Coordinates for d4ls7b1:

Click to download the PDB-style file with coordinates for d4ls7b1.
(The format of our PDB-style files is described here.)

Timeline for d4ls7b1: