SCOPe 2.08: Domain d4lp1a_: 4lp1 A:

Lineage for d4lp1a_ (4lp1 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families)

5. Family d.82.2.0: automated matches [227291] (1 protein)
   not a true family

6. Protein automated matches [227112] (1 species)
   not a true protein

7. Species Psychromonas ingrahamii [TaxId:357804] [226618] (3 PDB entries)

8. Domain d4lp1a_: 4lp1 A: [266685]
   automated match to d4hs5a_
   complexed with eu3

Details for d4lp1a_

PDB Entry: 4lp1, 1.8 Å

PDB Description: crystal structure of cyay protein from psychromonas ingrahamii in complex with eu(iii)

PDB Compounds: (A:) Protein cyaY

SCOPe Domain Sequences for d4lp1a_:

Sequence; same for both SEQRES and ATOM records:

>d4lp1a_ d.82.2.0 (A:) automated matches {Psychromonas ingrahamii [TaxId: 357804]}
mndsefiqladqlyqkieekieesgadvdydqngslltlefenhtkliinrqqplhqvwl
atlenghhydynngkwiddrsgdefltflsaaifkqsketvdft

Timeline for d4lp1a_:

• d4lp1a_ first appeared in SCOPe 2.05
  
• d4lp1a_ appears in SCOPe 2.07