Lineage for d4lnmb_ (4lnm B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897164Species Escherichia coli [TaxId:945433] [267966] (3 PDB entries)
  8. 2897170Domain d4lnmb_: 4lnm B: [266684]
    automated match to d3wgba_
    complexed with ca, epe, plg, plr

Details for d4lnmb_

PDB Entry: 4lnm (more details), 2.1 Å

PDB Description: Structure of Escherichia coli Threonine Aldolase in Complex with Serine
PDB Compounds: (B:) Low-specificity L-threonine aldolase

SCOPe Domain Sequences for d4lnmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnmb_ c.67.1.0 (B:) automated matches {Escherichia coli [TaxId: 945433]}
midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
inaspivrlvthldvsraqlaevaahwrafl

SCOPe Domain Coordinates for d4lnmb_:

Click to download the PDB-style file with coordinates for d4lnmb_.
(The format of our PDB-style files is described here.)

Timeline for d4lnmb_: