![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (98 species) not a true protein |
![]() | Species Escherichia coli [TaxId:945433] [267966] (3 PDB entries) |
![]() | Domain d4lnma_: 4lnm A: [266683] automated match to d3wgba_ complexed with ca, epe, plg, plr |
PDB Entry: 4lnm (more details), 2.1 Å
SCOPe Domain Sequences for d4lnma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnma_ c.67.1.0 (A:) automated matches {Escherichia coli [TaxId: 945433]} midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl inaspivrlvthldvsraqlaevaahwrafl
Timeline for d4lnma_: