Lineage for d4lnja_ (4lnj A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504797Species Escherichia coli [TaxId:945433] [267966] (3 PDB entries)
  8. 2504800Domain d4lnja_: 4lnj A: [266679]
    automated match to d3wgba_
    complexed with epe, mg, plr

Details for d4lnja_

PDB Entry: 4lnj (more details), 2.1 Å

PDB Description: Structure of Escherichia coli Threonine Aldolase in Unliganded Form
PDB Compounds: (A:) Low-specificity L-threonine aldolase

SCOPe Domain Sequences for d4lnja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnja_ c.67.1.0 (A:) automated matches {Escherichia coli [TaxId: 945433]}
midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
inaspivrlvthldvsraqlaevaahwrafla

SCOPe Domain Coordinates for d4lnja_:

Click to download the PDB-style file with coordinates for d4lnja_.
(The format of our PDB-style files is described here.)

Timeline for d4lnja_: