Lineage for d4ln5a_ (4ln5 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (145 species)
    not a true protein
  7. 2487402Species Burkholderia ambifaria [TaxId:339670] [267965] (3 PDB entries)
  8. 2487405Domain d4ln5a_: 4ln5 A: [266676]
    automated match to d4p47a_
    complexed with cl, gol

Details for d4ln5a_

PDB Entry: 4ln5 (more details), 2.1 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bamb_6123), target efi-510059, with bound glycerol and chloride ion
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4ln5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln5a_ c.94.1.0 (A:) automated matches {Burkholderia ambifaria [TaxId: 339670]}
rvfrsadvhgdsfptnmavkfmgdelskltggkdsikvfgnsalgsekdtvdqvrigaid
marvngasfneivpeslipsfpflfrdvdhfrkamygpagqkildafaakgmialtfyes
garsiyakrpvrtpadmkglkvrvqpsdlmvdeiramggtptpmpfaevytglktglvda
aennlpsyeetkhfevapdysetqhamtpevlvfskkiwdtlspqeqaairkaaadsvpy
yqklwtareasaqqavtkgganilpaaqvdraafvkamqplwtkyektpqmkqivdeiea
tk

SCOPe Domain Coordinates for d4ln5a_:

Click to download the PDB-style file with coordinates for d4ln5a_.
(The format of our PDB-style files is described here.)

Timeline for d4ln5a_: