Lineage for d4lg2d_ (4lg2 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012029Fold d.388: Filoviridae VP35-like [267590] (1 superfamily)
    consists of two subdomains: four-helix bundle; and a 4-stranded mixed beta sheet (order 1342), 2nd strand is very short
  4. 3012030Superfamily d.388.1: Filoviridae VP35-like [267597] (2 families) (S)
    Pfam PF02097; PubMed 19122151
  5. 3012031Family d.388.1.1: Filoviridae VP35 [267610] (1 protein)
  6. 3012032Protein Filoviridae VP35 [267648] (5 species)
  7. 3012047Species Reston ebolavirus [TaxId:386032] [267710] (2 PDB entries)
  8. 3012052Domain d4lg2d_: 4lg2 D: [266674]
    protein/RNA complex

Details for d4lg2d_

PDB Entry: 4lg2 (more details), 2.7 Å

PDB Description: crystal structure of reston ebola virus vp35 rna binding domain bound to 12-bp dsrna
PDB Compounds: (D:) Polymerase cofactor

SCOPe Domain Sequences for d4lg2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lg2d_ d.388.1.1 (D:) Filoviridae VP35 {Reston ebolavirus [TaxId: 386032]}
isakdlkeimydhlpgfgtafhqlvqvickigkdnnlldtihaefqasladgdspqcali
qitkrvpifqdvpppiihirsrgdipracqkslrpappspkidrgwvclfkmqdgktlgl
ki

SCOPe Domain Coordinates for d4lg2d_:

Click to download the PDB-style file with coordinates for d4lg2d_.
(The format of our PDB-style files is described here.)

Timeline for d4lg2d_: