SCOP 1.61: Domain d8hvpb_: 8hvp B:

Lineage for d8hvpb_ (8hvp B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (141 PDB entries)

8. Domain d8hvpb_: 8hvp B: [26667]

Details for d8hvpb_

PDB Entry: 8hvp, 2.5 Å

PDB Description: structure at 2.5-angstroms resolution of chemically synthesized human immunodeficiency virus type 1 protease complexed with a hydroxyethylene*-based inhibitor

SCOP Domain Sequences for d8hvpb_:

Sequence; same for both SEQRES and ATOM records:

>d8hvpb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

Timeline for d8hvpb_:

• d8hvpb_ first appeared (with stable ids) in SCOP 1.55
  
• d8hvpb_ appears in SCOP 1.59
  
• d8hvpb_ appears in SCOP 1.63
  
• d8hvpb_ appears in the current release, SCOPe 2.08