Lineage for d4lf2d1 (4lf2 D:1-138)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909384Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1909385Protein automated matches [226983] (12 species)
    not a true protein
  7. 1909510Species Rhodopseudomonas palustris [TaxId:258594] [257015] (2 PDB entries)
  8. 1909514Domain d4lf2d1: 4lf2 D:1-138 [266665]
    Other proteins in same PDB: d4lf2a2, d4lf2b2, d4lf2c2, d4lf2d2, d4lf2e2, d4lf2f2
    automated match to d4lf1a1
    complexed with co3, mg, so4

Details for d4lf2d1

PDB Entry: 4lf2 (more details), 2.38 Å

PDB Description: hexameric form ii rubisco from rhodopseudomonas palustris, activated and complexed with sulfate and magnesium
PDB Compounds: (D:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d4lf2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lf2d1 d.58.9.0 (D:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d4lf2d1:

Click to download the PDB-style file with coordinates for d4lf2d1.
(The format of our PDB-style files is described here.)

Timeline for d4lf2d1: