Lineage for d4lf2c1 (4lf2 C:1-138)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195894Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2196090Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2196091Protein automated matches [226983] (18 species)
    not a true protein
  7. 2196291Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries)
  8. 2196294Domain d4lf2c1: 4lf2 C:1-138 [266663]
    Other proteins in same PDB: d4lf2a2, d4lf2b2, d4lf2c2, d4lf2d2, d4lf2e2, d4lf2f2
    automated match to d4lf1a1
    complexed with co3, mg, so4

Details for d4lf2c1

PDB Entry: 4lf2 (more details), 2.38 Å

PDB Description: hexameric form ii rubisco from rhodopseudomonas palustris, activated and complexed with sulfate and magnesium
PDB Compounds: (C:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d4lf2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lf2c1 d.58.9.0 (C:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d4lf2c1:

Click to download the PDB-style file with coordinates for d4lf2c1.
(The format of our PDB-style files is described here.)

Timeline for d4lf2c1: