SCOPe 2.05: Domain d8hvpa_: 8hvp A:

Lineage for d8hvpa_ (8hvp A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d8hvpa_: 8hvp A: [26666]

Details for d8hvpa_

PDB Entry: 8hvp, 2.5 Å

PDB Description: structure at 2.5-angstroms resolution of chemically synthesized human immunodeficiency virus type 1 protease complexed with a hydroxyethylene*-based inhibitor

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d8hvpa_:

Sequence; same for both SEQRES and ATOM records:

>d8hvpa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d8hvpa_:

• d8hvpa_ first appeared (with stable ids) in SCOP 1.55
  
• d8hvpa_ appears in SCOPe 2.04
  
• d8hvpa_ appears in SCOPe 2.06
  
• d8hvpa_ appears in the current release, SCOPe 2.08