SCOP 1.65: Domain d8hvpa_: 8hvp A:

Lineage for d8hvpa_ (8hvp A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (152 PDB entries)

8. Domain d8hvpa_: 8hvp A: [26666]

Details for d8hvpa_

PDB Entry: 8hvp, 2.5 Å

PDB Description: structure at 2.5-angstroms resolution of chemically synthesized human immunodeficiency virus type 1 protease complexed with a hydroxyethylene*-based inhibitor

SCOP Domain Sequences for d8hvpa_:

Sequence; same for both SEQRES and ATOM records:

>d8hvpa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

Timeline for d8hvpa_:

• d8hvpa_ first appeared (with stable ids) in SCOP 1.55
  
• d8hvpa_ appears in SCOP 1.63
  
• d8hvpa_ appears in SCOP 1.67
  
• d8hvpa_ appears in the current release, SCOPe 2.08