Lineage for d4le1a_ (4le1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855841Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)
  8. 2855842Domain d4le1a_: 4le1 A: [266657]
    automated match to d4le2a_
    complexed with act, gol, so4

Details for d4le1a_

PDB Entry: 4le1 (more details), 1.95 Å

PDB Description: crystal structure of the receiver domain of desr in the inactive state
PDB Compounds: (A:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d4le1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4le1a_ c.23.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmedly

SCOPe Domain Coordinates for d4le1a_:

Click to download the PDB-style file with coordinates for d4le1a_.
(The format of our PDB-style files is described here.)

Timeline for d4le1a_: