![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries) |
![]() | Domain d4le1a_: 4le1 A: [266657] automated match to d4le2a_ complexed with act, gol, so4 |
PDB Entry: 4le1 (more details), 1.95 Å
SCOPe Domain Sequences for d4le1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4le1a_ c.23.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk riyapelmedly
Timeline for d4le1a_: