| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries) |
| Domain d4le0b_: 4le0 B: [266656] automated match to d4le2a_ protein/DNA complex; complexed with act, bef, gol, mg |
PDB Entry: 4le0 (more details), 2.27 Å
SCOPe Domain Sequences for d4le0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4le0b_ c.23.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmedlys
Timeline for d4le0b_: