Lineage for d4lcba_ (4lcb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2113905Species Acidianus hospitalis [TaxId:933801] [267963] (1 PDB entry)
  8. 2113906Domain d4lcba_: 4lcb A: [266654]
    automated match to d2x8aa_
    complexed with cl

Details for d4lcba_

PDB Entry: 4lcb (more details), 2.08 Å

PDB Description: Structure of Vps4 homolog from Acidianus hospitalis
PDB Compounds: (A:) Cell division protein CdvC, Vps4

SCOPe Domain Sequences for d4lcba_:

Sequence, based on SEQRES records: (download)

>d4lcba_ c.37.1.0 (A:) automated matches {Acidianus hospitalis [TaxId: 933801]}
kvsfsdivglddvkealkeaiiypskrpdlfplgwprgillygppgngktmlaaavanei
dsyfihvdaasimskwlgeaeknvakifntareyskkdnkpaiifvdeidallgtytsev
ggevrvrnqflkemdgimdknenymvyvigatnkpwrldepflrrfqkriyvplpdfnqr
lalfkyytskvklgnvdlqelakmtegysasdirdivqsahmrvvkemfeknlsepreit
mddfkevlkirkpsvnqellkayeawtekf

Sequence, based on observed residues (ATOM records): (download)

>d4lcba_ c.37.1.0 (A:) automated matches {Acidianus hospitalis [TaxId: 933801]}
kvsfsdivglddvkealkeaiiypskrpdlfplgwprgillygppgngktmlaaavanei
dsyfihvdaasimskgeaeknvakifntareyskkdnkpaiifvdeidallvrvrnqflk
emdgimmvyvigatnkpwrldepflrrfqkriyvplpdfnqrlalfkyytskvklgnvdl
qelakmtegysasdirdivqsahmrvvkemfeknlsepreitmddfkevlkirkpsvnqe
llkayeawtekf

SCOPe Domain Coordinates for d4lcba_:

Click to download the PDB-style file with coordinates for d4lcba_.
(The format of our PDB-style files is described here.)

Timeline for d4lcba_: