| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (31 species) not a true protein |
| Species Pseudomonas sp. [TaxId:165468] [256995] (2 PDB entries) |
| Domain d4lafa_: 4laf A: [266650] automated match to d4la4a_ complexed with fmn |
PDB Entry: 4laf (more details), 1.76 Å
SCOPe Domain Sequences for d4lafa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lafa_ c.23.5.0 (A:) automated matches {Pseudomonas sp. [TaxId: 165468]}
mptkiqivfyssyghiykmaeaiaagarevgdvevtllqvpelmpeevqvksgikgyraa
fgsipyatpevlaeadaiifgtptrfgnmcsqmrnfldqtgglwmsggligkvgsvftst
asqhggqettitsfhttllhhgmvivgvpysepgltnmteisggtpygastlagadgsrq
psenelqiarfqgkhvatiakrlannk
Timeline for d4lafa_: