Lineage for d4lafa_ (4laf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2857089Species Pseudomonas sp. [TaxId:165468] [256995] (2 PDB entries)
  8. 2857090Domain d4lafa_: 4laf A: [266650]
    automated match to d4la4a_
    complexed with fmn

Details for d4lafa_

PDB Entry: 4laf (more details), 1.76 Å

PDB Description: Crystal structure of PnpB complex with FMN
PDB Compounds: (A:) NAD(P)H dehydrogenase (quinone)

SCOPe Domain Sequences for d4lafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lafa_ c.23.5.0 (A:) automated matches {Pseudomonas sp. [TaxId: 165468]}
mptkiqivfyssyghiykmaeaiaagarevgdvevtllqvpelmpeevqvksgikgyraa
fgsipyatpevlaeadaiifgtptrfgnmcsqmrnfldqtgglwmsggligkvgsvftst
asqhggqettitsfhttllhhgmvivgvpysepgltnmteisggtpygastlagadgsrq
psenelqiarfqgkhvatiakrlannk

SCOPe Domain Coordinates for d4lafa_:

Click to download the PDB-style file with coordinates for d4lafa_.
(The format of our PDB-style files is described here.)

Timeline for d4lafa_: