Lineage for d4l9pa_ (4l9p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007074Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2007203Family a.118.6.0: automated matches [267630] (1 protein)
    not a true family
  6. 2007204Protein automated matches [267683] (4 species)
    not a true protein
  7. 2007205Species Aspergillus fumigatus [TaxId:330879] [267962] (4 PDB entries)
  8. 2007206Domain d4l9pa_: 4l9p A: [266649]
    automated match to d1d8da_
    complexed with cl, edo, fii, zn

Details for d4l9pa_

PDB Entry: 4l9p (more details), 1.45 Å

PDB Description: Crystal structure of Aspergillus fumigatus protein farnesyltransferase complexed with the FII analog, FPT-II, and the KCVVM peptide
PDB Compounds: (A:) CaaX farnesyltransferase alpha subunit Ram2

SCOPe Domain Sequences for d4l9pa_:

Sequence, based on SEQRES records: (download)

>d4l9pa_ a.118.6.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
gkyssdpewasikpielndgsdfgamplatisyspeyleatsylravmaanemseralrl
tgdiismnpahytvwiyrakilfalgkdlneeiewlnkvalkhlknyqiwhhrqvlmssr
ahfptlppreqdflmemfaqdaksyhvwtyrhwlvrhfklwdhpreiqdveallkadvrn
nsawnhrymlrfgprdenefdaglhnttgpssekgrlpvvdedlvdselqysqsrileap
enrspwsyargvlqaagrplsewkdfarsfvvekqengqvvdvavksshaiewladvyae
edgsegsaaeavkmltllkekydpirrnyweyrirqitasaahatei

Sequence, based on observed residues (ATOM records): (download)

>d4l9pa_ a.118.6.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
gkyssdpewasikpielndgsdfgamplatisyspeyleatsylravmaanemseralrl
tgdiismnpahytvwiyrakilfalgkdlneeiewlnkvalkhlknyqiwhhrqvlmssr
ahfptlppreqdflmemfaqdaksyhvwtyrhwlvrhfklwdhpreiqdveallkadvrn
nsawnhrymlrfgprdenefdaglhnttgpssekgrlpvvdedlvdselqysqsrileap
enrspwsyargvlqaagrplsewkdfarsfvavksshaiewladvyaeedgsegsaaeav
kmltllkekydpirrnyweyrirqitasaahatei

SCOPe Domain Coordinates for d4l9pa_:

Click to download the PDB-style file with coordinates for d4l9pa_.
(The format of our PDB-style files is described here.)

Timeline for d4l9pa_: