Lineage for d4l98a_ (4l98 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008960Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2008961Species Human (Homo sapiens) [TaxId:9606] [48525] (111 PDB entries)
    Uniprot P37231 232-505
  8. 2009070Domain d4l98a_: 4l98 A: [266647]
    automated match to d3ty0a_
    complexed with lrg; mutant

Details for d4l98a_

PDB Entry: 4l98 (more details), 2.28 Å

PDB Description: crystal structure of the complex of f360l ppargamma mutant with the ligand lt175
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d4l98a_:

Sequence, based on SEQRES records: (download)

>d4l98a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
sadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkhi
tplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiy
tmlaslmnkdgvlisegqgfmtreflkslrkplgdfmepkfefavkfnalelddsdlaif
iaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivt
ehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d4l98a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
sadlralakhlydsyiksfpltkakarailtgkttdkspfvievairifqgcqfrsveav
qeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtrefl
kslrkplgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnl
lqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiy
kdly

SCOPe Domain Coordinates for d4l98a_:

Click to download the PDB-style file with coordinates for d4l98a_.
(The format of our PDB-style files is described here.)

Timeline for d4l98a_: