Lineage for d4l95k_ (4l95 K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859513Species Zebrafish (Danio rerio) [TaxId:7955] [256984] (5 PDB entries)
  8. 2859538Domain d4l95k_: 4l95 K: [266645]
    automated match to d4l8wb_
    complexed with gol

Details for d4l95k_

PDB Entry: 4l95 (more details), 2.34 Å

PDB Description: Crystal structure of gamma glutamyl hydrolase (H218N) from zebrafish
PDB Compounds: (K:) gamma-glutamyl hydrolase

SCOPe Domain Sequences for d4l95k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l95k_ c.23.16.0 (K:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
kkfyrvlstntdgynkfvstmeaydfpiyatqwnpeknafewtrpyiphtpsaikttfym
anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn

SCOPe Domain Coordinates for d4l95k_:

Click to download the PDB-style file with coordinates for d4l95k_.
(The format of our PDB-style files is described here.)

Timeline for d4l95k_: