Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.11: Kelch motif [117281] (2 families) |
Family b.68.11.1: Kelch motif [117282] (2 proteins) Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967) |
Protein automated matches [190126] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries) |
Domain d4l7cc1: 4l7c C:326-609 [266631] Other proteins in same PDB: d4l7ca2, d4l7cb2, d4l7cc2 automated match to d4in4c_ complexed with 1vw, act |
PDB Entry: 4l7c (more details), 2.4 Å
SCOPe Domain Sequences for d4l7cc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l7cc1 b.68.11.1 (C:326-609) automated matches {Human (Homo sapiens) [TaxId: 9606]} rliytaggyfrqslsyleaynpsdgtwldladlqvprsglagcvvggllyavggrnnspd gntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsveryep erdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamnt irsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhqgr iyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
Timeline for d4l7cc1:
View in 3D Domains from other chains: (mouse over for more information) d4l7ca1, d4l7ca2, d4l7cb1, d4l7cb2 |