SCOP 1.69: Domain d4hvpb_: 4hvp B:

Lineage for d4hvpb_ (4hvp B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (166 PDB entries)

8. Domain d4hvpb_: 4hvp B: [26663]

Details for d4hvpb_

PDB Entry: 4hvp, 2.3 Å

PDB Description: structure of complex of synthetic hiv-1 protease with a substrate- based inhibitor at 2.3 angstroms resolution

SCOP Domain Sequences for d4hvpb_:

Sequence; same for both SEQRES and ATOM records:

>d4hvpb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

Timeline for d4hvpb_:

• d4hvpb_ first appeared (with stable ids) in SCOP 1.55
  
• d4hvpb_ appears in SCOP 1.67
  
• d4hvpb_ appears in SCOP 1.71
  
• d4hvpb_ appears in the current release, SCOPe 2.08