Lineage for d4l7ca1 (4l7c A:326-609)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418094Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2418095Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2418104Protein automated matches [190126] (2 species)
    not a true protein
  7. 2418105Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries)
  8. 2418140Domain d4l7ca1: 4l7c A:326-609 [266629]
    Other proteins in same PDB: d4l7ca2, d4l7cb2, d4l7cc2
    automated match to d4in4c_
    complexed with 1vw, act

Details for d4l7ca1

PDB Entry: 4l7c (more details), 2.4 Å

PDB Description: Structure of keap1 kelch domain with 2-{[(1S)-2-{[(1R,2S)-2-(1H-tetrazol-5-yl)cyclohexyl]carbonyl}-1,2,3,4-tetrahydroisoquinolin-1-yl]methyl}-1H-isoindole-1,3(2H)-dione
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4l7ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l7ca1 b.68.11.1 (A:326-609) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rliytaggyfrqslsyleaynpsdgtwldladlqvprsglagcvvggllyavggrnnspd
gntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsveryep
erdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamnt
irsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhqgr
iyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d4l7ca1:

Click to download the PDB-style file with coordinates for d4l7ca1.
(The format of our PDB-style files is described here.)

Timeline for d4l7ca1: