SCOPe 2.05: Domain d4l7ca_: 4l7c A:

Lineage for d4l7ca_ (4l7c A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.1: Kelch motif [117282] (2 proteins)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)

6. Protein automated matches [190126] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193097] (11 PDB entries)

8. Domain d4l7ca_: 4l7c A: [266629]
   automated match to d4in4c_
   complexed with 1vw, act

Details for d4l7ca_

PDB Entry: 4l7c, 2.4 Å

PDB Description: Structure of keap1 kelch domain with 2-{[(1S)-2-{[(1R,2S)-2-(1H-tetrazol-5-yl)cyclohexyl]carbonyl}-1,2,3,4-tetrahydroisoquinolin-1-yl]methyl}-1H-isoindole-1,3(2H)-dione

PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4l7ca_:

Sequence; same for both SEQRES and ATOM records:

>d4l7ca_ b.68.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rliytaggyfrqslsyleaynpsdgtwldladlqvprsglagcvvggllyavggrnnspd
gntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsveryep
erdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamnt
irsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhqgr
iyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavtle

Timeline for d4l7ca_:

• d4l7ca_ is new in SCOPe 2.05-stable
  
• d4l7ca_ is called d4l7ca1 in SCOPe 2.06
  
• d4l7ca_ appears in the current release, SCOPe 2.08, called d4l7ca1