SCOPe 2.07: Domain d4l7bb1: 4l7b B:321-609

Lineage for d4l7bb1 (4l7b B:321-609)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.1: Kelch motif [117282] (2 proteins)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)

6. Protein automated matches [190126] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries)

8. Domain d4l7bb1: 4l7b B:321-609 [266628]
   Other proteins in same PDB: d4l7ba2, d4l7bb2
   automated match to d4in4c_
   complexed with 1vv, act, na

Details for d4l7bb1

PDB Entry: 4l7b, 2.41 Å

PDB Description: Structure of keap1 kelch domain with (1S,2R)-2-{[(1S)-1-[(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)methyl]-3,4-dihydroisoquinolin-2(1H)-yl]carbonyl}cyclohexanecarboxylic acid

PDB Compounds: (B:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4l7bb1:

Sequence; same for both SEQRES and ATOM records:

>d4l7bb1 b.68.11.1 (B:321-609) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apkvgrliytaggyfrqslsyleaynpsdgtwldladlqvprsglagcvvggllyavggr
nnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsv
eryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmi
tamntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgit
vhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

Timeline for d4l7bb1:

• d4l7bb1 first appeared in SCOPe 2.05, called d4l7bb_
  
• d4l7bb1 appears in SCOPe 2.06
  
• d4l7bb1 appears in the current release, SCOPe 2.08