Lineage for d4l51b_ (4l51 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151246Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2151247Protein automated matches [191112] (14 species)
    not a true protein
  7. 2151314Species Escherichia coli [TaxId:83333] [267961] (4 PDB entries)
  8. 2151316Domain d4l51b_: 4l51 B: [266625]
    automated match to d4r9na_
    protein/DNA complex; complexed with hsx

Details for d4l51b_

PDB Entry: 4l51 (more details), 1.9 Å

PDB Description: Crystal structures of the LsrR proteins complexed with phospho-AI-2 and its two different analogs reveal distinct mechanisms for ligand recognition
PDB Compounds: (B:) Transcriptional regulator LsrR

SCOPe Domain Sequences for d4l51b_:

Sequence, based on SEQRES records: (download)

>d4l51b_ c.124.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
fegcleyetqlrrqfslqhvrvipgladadvggrlgigaahmlmsllqpqqmlaigfgea
tmntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartl
knencvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgy
ffdakgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtd
qdtaaailrs

Sequence, based on observed residues (ATOM records): (download)

>d4l51b_ c.124.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
fegcleyetqlrrqfslqhvrvipgladvggrlgigaahmlmsllqpqqmlaigfgeatm
ntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartlkn
encvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgyff
dakgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtdqd
taaailrs

SCOPe Domain Coordinates for d4l51b_:

Click to download the PDB-style file with coordinates for d4l51b_.
(The format of our PDB-style files is described here.)

Timeline for d4l51b_: