![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
![]() | Protein automated matches [191112] (17 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [267961] (4 PDB entries) |
![]() | Domain d4l50a_: 4l50 A: [266622] automated match to d4r9na_ protein/DNA complex; complexed with d8x |
PDB Entry: 4l50 (more details), 2.1 Å
SCOPe Domain Sequences for d4l50a_:
Sequence, based on SEQRES records: (download)
>d4l50a_ c.124.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} fegcleyetqlrrqfslqhvrvipgladadvggrlgigaahmlmsllqpqqmlaigfgea tmntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartl knencvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgy ffdakgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtd qdtaaailrs
>d4l50a_ c.124.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} fegcleyetqlrrqfslqhvrvipgladvggrlgigaahmlmsllqpqqmlaigfgeatm ntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartlkn encvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgyff dakgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtdqd taaailrs
Timeline for d4l50a_: