Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
Protein automated matches [191112] (11 species) not a true protein |
Species Escherichia coli [TaxId:83333] [267961] (4 PDB entries) |
Domain d4l4za_: 4l4z A: [266620] automated match to d4r9na_ protein/DNA complex; complexed with d5x |
PDB Entry: 4l4z (more details), 2.3 Å
SCOPe Domain Sequences for d4l4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l4za_ c.124.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} egcleyetqlrrqfslqhvrvipgladadvggrlgigaahmlmsllqpqqmlaigfgeat mntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartlk nencvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgyf fdakgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtdq dtaaailrs
Timeline for d4l4za_: