Lineage for d4l4za_ (4l4z A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885422Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1885423Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1885702Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 1885703Protein automated matches [191112] (11 species)
    not a true protein
  7. 1885770Species Escherichia coli [TaxId:83333] [267961] (4 PDB entries)
  8. 1885777Domain d4l4za_: 4l4z A: [266620]
    automated match to d4r9na_
    protein/DNA complex; complexed with d5x

Details for d4l4za_

PDB Entry: 4l4z (more details), 2.3 Å

PDB Description: Crystal structures of the LsrR proteins complexed with phospho-AI-2 and its two different analogs reveal distinct mechanisms for ligand recognition
PDB Compounds: (A:) Transcriptional regulator LsrR

SCOPe Domain Sequences for d4l4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4za_ c.124.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
egcleyetqlrrqfslqhvrvipgladadvggrlgigaahmlmsllqpqqmlaigfgeat
mntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartlk
nencvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgyf
fdakgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtdq
dtaaailrs

SCOPe Domain Coordinates for d4l4za_:

Click to download the PDB-style file with coordinates for d4l4za_.
(The format of our PDB-style files is described here.)

Timeline for d4l4za_: