SCOP 1.61: Domain d4hvpa_: 4hvp A:

Lineage for d4hvpa_ (4hvp A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (141 PDB entries)

8. Domain d4hvpa_: 4hvp A: [26662]

Details for d4hvpa_

PDB Entry: 4hvp, 2.3 Å

PDB Description: structure of complex of synthetic hiv-1 protease with a substrate- based inhibitor at 2.3 angstroms resolution

SCOP Domain Sequences for d4hvpa_:

Sequence; same for both SEQRES and ATOM records:

>d4hvpa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

Timeline for d4hvpa_:

• d4hvpa_ first appeared (with stable ids) in SCOP 1.55
  
• d4hvpa_ appears in SCOP 1.59
  
• d4hvpa_ appears in SCOP 1.63
  
• d4hvpa_ appears in the current release, SCOPe 2.08