Lineage for d4l4ya_ (4l4y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151246Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2151247Protein automated matches [191112] (14 species)
    not a true protein
  7. 2151314Species Escherichia coli [TaxId:83333] [267961] (4 PDB entries)
  8. 2151317Domain d4l4ya_: 4l4y A: [266618]
    automated match to d4r9na_
    protein/DNA complex

Details for d4l4ya_

PDB Entry: 4l4y (more details), 1.9 Å

PDB Description: Crystal structures of the LsrR proteins complexed with phospho-AI-2 and its two different analogs reveal distinct mechanisms for ligand recognition
PDB Compounds: (A:) Transcriptional regulator LsrR

SCOPe Domain Sequences for d4l4ya_:

Sequence, based on SEQRES records: (download)

>d4l4ya_ c.124.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
egcleyetqlrrqfslqhvrvipgladadvggrlgigaahmlmsllqpqqmlaigfgeat
mntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartlk
nencvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgyf
fdakgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtdq
dtaaailrs

Sequence, based on observed residues (ATOM records): (download)

>d4l4ya_ c.124.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
egcleyetqlrrqfslqhvrvipgladvggrlgigaahmlmsllqpqqmlaigfgeatmn
tlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartlkne
ncvkdvllaaqaadvaivgigavsgyisqgeqlmigrkgavgdilgyffdakgdvvtnik
ihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtdqdtaaailrs

SCOPe Domain Coordinates for d4l4ya_:

Click to download the PDB-style file with coordinates for d4l4ya_.
(The format of our PDB-style files is described here.)

Timeline for d4l4ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4l4yb_