Lineage for d4kxqa_ (4kxq A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843167Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1843168Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1843520Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 1843521Protein automated matches [190312] (9 species)
    not a true protein
  7. 1843538Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)
  8. 1843546Domain d4kxqa_: 4kxq A: [266613]
    automated match to d4i5ia_
    complexed with apr, bme, gol, zn

Details for d4kxqa_

PDB Entry: 4kxq (more details), 1.85 Å

PDB Description: Structure of NAD-dependent protein deacetylase sirtuin-1 (closed state, 1.85 A)
PDB Compounds: (A:) NAD-dependent protein deacetylase sirtuin-1

SCOPe Domain Sequences for d4kxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxqa_ c.31.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmrkkrkdintiedavkllqeckkiivltgagvsvscgipdfrsrdgiyarlavdfpdlp
dpqamfdieyfrkdprpffkfakeiypgqfqpslchkfialsdkegkllrnytqnidtle
qvagiqriiqchgsfatasclickykvdceavrgdifnqvvprcprcpadeplaimkpei
vffgenlpeqfhramkydkdevdllivigsslkvrpvalipssiphevpqilinreplph
lhfdvellgdcdviinelchrlggeyaklccnpvklsei

SCOPe Domain Coordinates for d4kxqa_:

Click to download the PDB-style file with coordinates for d4kxqa_.
(The format of our PDB-style files is described here.)

Timeline for d4kxqa_: