SCOPe 2.08: Domain d4kwsg2: 4kws G:114-405

Lineage for d4kwsg2 (4kws G:114-405)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries)

8. Domain d4kwsg2: 4kws G:114-405 [266610]
   Other proteins in same PDB: d4kwsa1, d4kwsa3, d4kwsb1, d4kwsb3, d4kwsc1, d4kwsc3, d4kwsd1, d4kwsd3, d4kwse1, d4kwse3, d4kwsf1, d4kwsf3, d4kwsg1, d4kwsg3, d4kwsh1, d4kwsh3
   automated match to d4il2a2
   complexed with cl, gol, mg

Details for d4kwsg2

PDB Entry: 4kws, 1.64 Å

PDB Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg and glycerol

PDB Compounds: (G:) D-mannonate dehydratase

SCOPe Domain Sequences for d4kwsg2:

Sequence, based on SEQRES records:

>d4kwsg2 c.1.11.0 (G:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records):

>d4kwsg2 c.1.11.0 (G:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvepadsslpae
hvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledc
vpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrv
adlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfe
dghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Timeline for d4kwsg2:

• d4kwsg2 first appeared in SCOPe 2.05
  
• d4kwsg2 appears in SCOPe 2.07