Lineage for d4kwsc2 (4kws C:114-405)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837422Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries)
  8. 2837426Domain d4kwsc2: 4kws C:114-405 [266602]
    Other proteins in same PDB: d4kwsa1, d4kwsa3, d4kwsb1, d4kwsb3, d4kwsc1, d4kwsc3, d4kwsd1, d4kwsd3, d4kwse1, d4kwse3, d4kwsf1, d4kwsf3, d4kwsg1, d4kwsg3, d4kwsh1, d4kwsh3
    automated match to d4il2a2
    complexed with cl, gol, mg

Details for d4kwsc2

PDB Entry: 4kws (more details), 1.64 Å

PDB Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg and glycerol
PDB Compounds: (C:) D-mannonate dehydratase

SCOPe Domain Sequences for d4kwsc2:

Sequence, based on SEQRES records: (download)

>d4kwsc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records): (download)

>d4kwsc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvyepadsslpa
ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
edghflagespghgvdideelaakypyeraslpvnrledgtlwhw

SCOPe Domain Coordinates for d4kwsc2:

Click to download the PDB-style file with coordinates for d4kwsc2.
(The format of our PDB-style files is described here.)

Timeline for d4kwsc2: