SCOPe 2.05: Domain d4kwsc1: 4kws C:2-113

Lineage for d4kwsc1 (4kws C:2-113)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)

8. Domain d4kwsc1: 4kws C:2-113 [266601]
   Other proteins in same PDB: d4kwsa2, d4kwsb2, d4kwsc2, d4kwsd2, d4kwse2, d4kwsf2, d4kwsg2, d4kwsh2
   automated match to d4il2a1
   complexed with cl, gol, mg

Details for d4kwsc1

PDB Entry: 4kws, 1.64 Å

PDB Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg and glycerol

PDB Compounds: (C:) D-mannonate dehydratase

SCOPe Domain Sequences for d4kwsc1:

Sequence; same for both SEQRES and ATOM records:

>d4kwsc1 d.54.1.0 (C:2-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

Timeline for d4kwsc1:

• d4kwsc1 is new in SCOPe 2.05-stable
  
• d4kwsc1 appears in SCOPe 2.06
  
• d4kwsc1 appears in the current release, SCOPe 2.08