Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries) |
Domain d4kt2h2: 4kt2 H:114-405 [266593] Other proteins in same PDB: d4kt2a1, d4kt2b1, d4kt2c1, d4kt2d1, d4kt2e1, d4kt2f1, d4kt2g1, d4kt2h1 automated match to d4il2a2 complexed with cl, gol, mg, so4 |
PDB Entry: 4kt2 (more details), 1.8 Å
SCOPe Domain Sequences for d4kt2h2:
Sequence, based on SEQRES records: (download)
>d4kt2h2 c.1.11.0 (H:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw
>d4kt2h2 c.1.11.0 (H:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgpadsslpaehvwsteky lnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqes lrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyh vrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflage spghgvdideelaakypyeraslpvnrledgtlwhw
Timeline for d4kt2h2: