Lineage for d4kt2g1 (4kt2 G:4-113)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2554995Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)
  8. 2555021Domain d4kt2g1: 4kt2 G:4-113 [266590]
    Other proteins in same PDB: d4kt2a2, d4kt2a3, d4kt2b2, d4kt2b3, d4kt2c2, d4kt2c3, d4kt2d2, d4kt2d3, d4kt2e2, d4kt2e3, d4kt2f2, d4kt2f3, d4kt2g2, d4kt2g3, d4kt2h2, d4kt2h3
    automated match to d4il2a1
    complexed with cl, gol, mg, so4

Details for d4kt2g1

PDB Entry: 4kt2 (more details), 1.8 Å

PDB Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
PDB Compounds: (G:) D-mannonate dehydratase

SCOPe Domain Sequences for d4kt2g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kt2g1 d.54.1.0 (G:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d4kt2g1:

Click to download the PDB-style file with coordinates for d4kt2g1.
(The format of our PDB-style files is described here.)

Timeline for d4kt2g1: