Lineage for d4kt2e2 (4kt2 E:114-405)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2446023Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries)
  8. 2446047Domain d4kt2e2: 4kt2 E:114-405 [266587]
    Other proteins in same PDB: d4kt2a1, d4kt2a3, d4kt2b1, d4kt2b3, d4kt2c1, d4kt2c3, d4kt2d1, d4kt2d3, d4kt2e1, d4kt2e3, d4kt2f1, d4kt2f3, d4kt2g1, d4kt2g3, d4kt2h1, d4kt2h3
    automated match to d4il2a2
    complexed with cl, gol, mg, so4

Details for d4kt2e2

PDB Entry: 4kt2 (more details), 1.8 Å

PDB Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
PDB Compounds: (E:) D-mannonate dehydratase

SCOPe Domain Sequences for d4kt2e2:

Sequence, based on SEQRES records: (download)

>d4kt2e2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records): (download)

>d4kt2e2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettyyepadsslpaeh
vwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcv
paenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrva
dlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfed
ghflagespghgvdideelaakypyeraslpvnrledgtlwhw

SCOPe Domain Coordinates for d4kt2e2:

Click to download the PDB-style file with coordinates for d4kt2e2.
(The format of our PDB-style files is described here.)

Timeline for d4kt2e2: